Growth Factors Products

ALL

αβδγ

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

Product Name	Catalog #	Unit	Price/Unit
BMP - 2 Knuckle Epitope (73 - 92) KIPKASSVPTELSAISTLYL	14581-01	1 mg	$405	Cart Inquire
Growth Hormone Releasing Factor GRF (1 - 29) ami YADAIFTNSYRKVLGQLSARKLLQDIMSR-CONH2	11210-005	0.5 mg	$405	Cart Inquire
Insulin Growth Factor Binding Protein 6 (IGFBP6), APAVAEENPK	11216-01	1 mg	$375	Cart Inquire
Insulin Growth Factor Binding Protein 6 (IGFBP6 ), GPSEETTK	11217-01	1 mg	$375	Cart Inquire
Link N DHLSDNYTLDHDRAIH	11218-01	1 mg	$375	Cart Inquire
PDGF - BB peptide CSRNLIDC (S-S BONDED)	11215-01	1 mg	$845	Cart Inquire

Why Choose Bio-Synthesis

Trusted by biotech leaders worldwide for over 45 years of delivering high-quality, fast, and scalable synthetic biology solutions.